1642: Revisiting Puzzle 111: Mouse
Closed since about 7 years ago
Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction PredictionSummary
- Created
- February 27, 2019
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ
Top groups
-
1. Beta Folders100 pts. 9,905
-
-
-
-
-
-
-
-
-
-
1. LociOiling Lv 1100 pts. 9,905 -
-
-
-
-
-
-
-
-
Comments
LociOiling Lv 1
There are two mouse revisiting puzzles. Thanks to actiasluna for spotting my error. The correct reference for this puzzle is:
https://foldit.fandom.com/wiki/Revisiting_puzzle/Mouse_-_puzzle_111
(edit: went with a more clickable name for the puzzle 111 page)