Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Androids 11. Androids 4 pts. 9,710
  2. Avatar for HMT heritage 12. HMT heritage 3 pts. 9,670
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,573
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,482
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,462
  6. Avatar for freefolder 16. freefolder 1 pt. 9,456
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,353
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 9,334
  9. Avatar for Deleted group 19. Deleted group pts. 8,999
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,997
  1. Avatar for congautruc 111. congautruc Lv 1 1 pt. 9,135
  2. Avatar for GUANINJIN 112. GUANINJIN Lv 1 1 pt. 9,127
  3. Avatar for jamiexq 113. jamiexq Lv 1 1 pt. 9,092
  4. Avatar for KAOSkonfused 114. KAOSkonfused Lv 1 1 pt. 9,088
  5. Avatar for Staphylococcus_Aureus 115. Staphylococcus_Aureus Lv 1 1 pt. 9,088
  6. Avatar for Simek 116. Simek Lv 1 1 pt. 9,081
  7. Avatar for Willyanto 117. Willyanto Lv 1 1 pt. 9,077
  8. Avatar for lamoille 118. lamoille Lv 1 1 pt. 9,075
  9. Avatar for Squirrely 119. Squirrely Lv 1 1 pt. 9,073
  10. Avatar for mikim2018 120. mikim2018 Lv 1 1 pt. 9,056

Comments