Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Androids 11. Androids 4 pts. 9,710
  2. Avatar for HMT heritage 12. HMT heritage 3 pts. 9,670
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,573
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,482
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,462
  6. Avatar for freefolder 16. freefolder 1 pt. 9,456
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,353
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 9,334
  9. Avatar for Deleted group 19. Deleted group pts. 8,999
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,997

  1. Avatar for Phyx 21. Phyx Lv 1 49 pts. 9,736
  2. Avatar for Blipperman 22. Blipperman Lv 1 47 pts. 9,731
  3. Avatar for actiasluna 23. actiasluna Lv 1 45 pts. 9,731
  4. Avatar for Museka 24. Museka Lv 1 44 pts. 9,727
  5. Avatar for timroberts16 25. timroberts16 Lv 1 42 pts. 9,710
  6. Avatar for altejoh 26. altejoh Lv 1 40 pts. 9,706
  7. Avatar for Marvelz 27. Marvelz Lv 1 39 pts. 9,691
  8. Avatar for guineapig 28. guineapig Lv 1 37 pts. 9,689
  9. Avatar for silent gene 29. silent gene Lv 1 36 pts. 9,687
  10. Avatar for gdnskye 30. gdnskye Lv 1 34 pts. 9,687

Comments