Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Androids 11. Androids 4 pts. 9,710
  2. Avatar for HMT heritage 12. HMT heritage 3 pts. 9,670
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,573
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,482
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,462
  6. Avatar for freefolder 16. freefolder 1 pt. 9,456
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,353
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 9,334
  9. Avatar for Deleted group 19. Deleted group pts. 8,999
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 8,997

  1. Avatar for drumpeter18yrs9yrs 41. drumpeter18yrs9yrs Lv 1 21 pts. 9,644
  2. Avatar for joremen 42. joremen Lv 1 21 pts. 9,643
  3. Avatar for cobaltteal 43. cobaltteal Lv 1 20 pts. 9,639
  4. Avatar for Deleted player 44. Deleted player pts. 9,631
  5. Avatar for Glen B 45. Glen B Lv 1 18 pts. 9,622
  6. Avatar for MicElephant 46. MicElephant Lv 1 17 pts. 9,622
  7. Avatar for Idiotboy 47. Idiotboy Lv 1 16 pts. 9,619
  8. Avatar for jermainiac 48. jermainiac Lv 1 16 pts. 9,616
  9. Avatar for pvc78 49. pvc78 Lv 1 15 pts. 9,610
  10. Avatar for hansvandenhof 50. hansvandenhof Lv 1 14 pts. 9,602

Comments