Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,905
  2. Avatar for retiredmichael 2. retiredmichael Lv 1 97 pts. 9,868
  3. Avatar for crpainter 3. crpainter Lv 1 94 pts. 9,850
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 91 pts. 9,820
  5. Avatar for Aminal88 5. Aminal88 Lv 1 88 pts. 9,818
  6. Avatar for vakobo 6. vakobo Lv 1 85 pts. 9,813
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 82 pts. 9,811
  8. Avatar for Galaxie 8. Galaxie Lv 1 79 pts. 9,801
  9. Avatar for tyler0911 9. tyler0911 Lv 1 76 pts. 9,786
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 74 pts. 9,773

Comments