Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,905
  2. Avatar for Contenders 2. Contenders 79 pts. 9,850
  3. Avatar for Go Science 3. Go Science 61 pts. 9,820
  4. Avatar for Hold My Beer 4. Hold My Beer 47 pts. 9,818
  5. Avatar for Russian team 5. Russian team 35 pts. 9,815
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 26 pts. 9,803
  7. Avatar for Marvin's bunch 7. Marvin's bunch 19 pts. 9,789
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,773
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,745
  10. Avatar for Gargleblasters 10. Gargleblasters 7 pts. 9,731
  1. Avatar for phi16 11. phi16 Lv 1 8 pts. 9,788
  2. Avatar for lamoille 12. lamoille Lv 1 6 pts. 9,788
  3. Avatar for gdnskye 13. gdnskye Lv 1 4 pts. 9,788
  4. Avatar for jermainiac 14. jermainiac Lv 1 3 pts. 9,787
  5. Avatar for robgee 15. robgee Lv 1 2 pts. 9,784
  6. Avatar for Phyx 16. Phyx Lv 1 2 pts. 9,782
  7. Avatar for alwen 17. alwen Lv 1 1 pt. 9,781
  8. Avatar for alcor29 18. alcor29 Lv 1 1 pt. 9,781
  9. Avatar for jausmh 19. jausmh Lv 1 1 pt. 9,763
  10. Avatar for Maerlyn138 20. Maerlyn138 Lv 1 1 pt. 9,729

Comments