Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 9,905
  2. Avatar for Contenders 2. Contenders 79 pts. 9,850
  3. Avatar for Go Science 3. Go Science 61 pts. 9,820
  4. Avatar for Hold My Beer 4. Hold My Beer 47 pts. 9,818
  5. Avatar for Russian team 5. Russian team 35 pts. 9,815
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 26 pts. 9,803
  7. Avatar for Marvin's bunch 7. Marvin's bunch 19 pts. 9,789
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,773
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,745
  10. Avatar for Gargleblasters 10. Gargleblasters 7 pts. 9,731

  1. Avatar for Phyx 21. Phyx Lv 1 49 pts. 9,736
  2. Avatar for Blipperman 22. Blipperman Lv 1 47 pts. 9,731
  3. Avatar for actiasluna 23. actiasluna Lv 1 45 pts. 9,731
  4. Avatar for Museka 24. Museka Lv 1 44 pts. 9,727
  5. Avatar for timroberts16 25. timroberts16 Lv 1 42 pts. 9,710
  6. Avatar for altejoh 26. altejoh Lv 1 40 pts. 9,706
  7. Avatar for Marvelz 27. Marvelz Lv 1 39 pts. 9,691
  8. Avatar for guineapig 28. guineapig Lv 1 37 pts. 9,689
  9. Avatar for silent gene 29. silent gene Lv 1 36 pts. 9,687
  10. Avatar for gdnskye 30. gdnskye Lv 1 34 pts. 9,687

Comments