Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 9,905
  2. Avatar for Contenders 2. Contenders 79 pts. 9,850
  3. Avatar for Go Science 3. Go Science 61 pts. 9,820
  4. Avatar for Hold My Beer 4. Hold My Beer 47 pts. 9,818
  5. Avatar for Russian team 5. Russian team 35 pts. 9,815
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 26 pts. 9,803
  7. Avatar for Marvin's bunch 7. Marvin's bunch 19 pts. 9,789
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,773
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,745
  10. Avatar for Gargleblasters 10. Gargleblasters 7 pts. 9,731

  1. Avatar for rezaefar 61. rezaefar Lv 1 8 pts. 9,544
  2. Avatar for hada 62. hada Lv 1 8 pts. 9,525
  3. Avatar for Crossed Sticks 63. Crossed Sticks Lv 1 7 pts. 9,521
  4. Avatar for benrh 64. benrh Lv 1 7 pts. 9,519
  5. Avatar for dbuske 65. dbuske Lv 1 7 pts. 9,517
  6. Avatar for Sissue 66. Sissue Lv 1 6 pts. 9,513
  7. Avatar for Hellcat6 67. Hellcat6 Lv 1 6 pts. 9,502
  8. Avatar for diamonddays 68. diamonddays Lv 1 6 pts. 9,499
  9. Avatar for alcor29 69. alcor29 Lv 1 5 pts. 9,498
  10. Avatar for heather-1 70. heather-1 Lv 1 5 pts. 9,495

Comments