Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Beta Folders 100 pts. 9,905
  2. Avatar for Contenders 2. Contenders 79 pts. 9,850
  3. Avatar for Go Science 3. Go Science 61 pts. 9,820
  4. Avatar for Hold My Beer 4. Hold My Beer 47 pts. 9,818
  5. Avatar for Russian team 5. Russian team 35 pts. 9,815
  6. Avatar for Anthropic Dreams 6. Anthropic Dreams 26 pts. 9,803
  7. Avatar for Marvin's bunch 7. Marvin's bunch 19 pts. 9,789
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,773
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 10 pts. 9,745
  10. Avatar for Gargleblasters 10. Gargleblasters 7 pts. 9,731

  1. Avatar for ti_go_Mars 91. ti_go_Mars Lv 1 1 pt. 9,363
  2. Avatar for DodoBird 92. DodoBird Lv 1 1 pt. 9,358
  3. Avatar for oureion 93. oureion Lv 1 1 pt. 9,353
  4. Avatar for ManVsYard 94. ManVsYard Lv 1 1 pt. 9,353
  5. Avatar for PlagueRat 95. PlagueRat Lv 1 1 pt. 9,349
  6. Avatar for MrZanav 96. MrZanav Lv 1 1 pt. 9,348
  7. Avatar for Zainul0103 97. Zainul0103 Lv 1 1 pt. 9,334
  8. Avatar for ehhan2018 98. ehhan2018 Lv 1 1 pt. 9,326
  9. Avatar for Anton Larin 99. Anton Larin Lv 1 1 pt. 9,325
  10. Avatar for Steven Pletsch 100. Steven Pletsch Lv 1 1 pt. 9,312

Comments