Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,361
  2. Avatar for jermainiac 2. jermainiac Lv 1 97 pts. 10,329
  3. Avatar for fiendish_ghoul 3. fiendish_ghoul Lv 1 94 pts. 10,303
  4. Avatar for actiasluna 4. actiasluna Lv 1 91 pts. 10,294
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 87 pts. 10,243
  6. Avatar for grogar7 6. grogar7 Lv 1 84 pts. 10,233
  7. Avatar for Galaxie 7. Galaxie Lv 1 81 pts. 10,231
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 79 pts. 10,157
  9. Avatar for Phyx 9. Phyx Lv 1 76 pts. 10,053
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 73 pts. 10,041

Comments