Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,361
  2. Avatar for jermainiac 2. jermainiac Lv 1 97 pts. 10,329
  3. Avatar for fiendish_ghoul 3. fiendish_ghoul Lv 1 94 pts. 10,303
  4. Avatar for actiasluna 4. actiasluna Lv 1 91 pts. 10,294
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 87 pts. 10,243
  6. Avatar for grogar7 6. grogar7 Lv 1 84 pts. 10,233
  7. Avatar for Galaxie 7. Galaxie Lv 1 81 pts. 10,231
  8. Avatar for Skippysk8s 8. Skippysk8s Lv 1 79 pts. 10,157
  9. Avatar for Phyx 9. Phyx Lv 1 76 pts. 10,053
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 73 pts. 10,041

Comments