Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815
  1. Avatar for retiredmichael 11. retiredmichael Lv 1 10 pts. 10,243
  2. Avatar for Blipperman 12. Blipperman Lv 1 8 pts. 10,236
  3. Avatar for phi16 13. phi16 Lv 1 6 pts. 10,171
  4. Avatar for alcor29 14. alcor29 Lv 1 4 pts. 10,160
  5. Avatar for jamiexq 15. jamiexq Lv 1 3 pts. 10,157
  6. Avatar for lamoille 16. lamoille Lv 1 2 pts. 10,131
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 2 pts. 10,058
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 1 pt. 10,055
  9. Avatar for Maerlyn138 19. Maerlyn138 Lv 1 1 pt. 10,038
  10. Avatar for Hollinas 20. Hollinas Lv 1 1 pt. 10,033

Comments