Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for MrZanav 101. MrZanav Lv 1 1 pt. 8,179
  2. Avatar for Vincera 102. Vincera Lv 1 1 pt. 8,117
  3. Avatar for Alistair69 103. Alistair69 Lv 1 1 pt. 8,015
  4. Avatar for Lyshi2018 104. Lyshi2018 Lv 1 1 pt. 8,009
  5. Avatar for alwan2018 105. alwan2018 Lv 1 1 pt. 8,001
  6. Avatar for Knoblerine 106. Knoblerine Lv 1 1 pt. 7,939
  7. Avatar for benz888 107. benz888 Lv 1 1 pt. 7,938
  8. Avatar for P-51 Mustang 108. P-51 Mustang Lv 1 1 pt. 7,920
  9. Avatar for Zainul0103 109. Zainul0103 Lv 1 1 pt. 7,919
  10. Avatar for NinguLilium 110. NinguLilium Lv 1 1 pt. 7,867

Comments