Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for congautruc 111. congautruc Lv 1 1 pt. 7,830
  2. Avatar for NotJim99 112. NotJim99 Lv 1 1 pt. 7,732
  3. Avatar for ironchefnorse 113. ironchefnorse Lv 1 1 pt. 7,705
  4. Avatar for Znaika 114. Znaika Lv 1 1 pt. 7,655
  5. Avatar for xbp 115. xbp Lv 1 1 pt. 7,624
  6. Avatar for jdmclure 116. jdmclure Lv 1 1 pt. 7,491
  7. Avatar for kangchingfan 118. kangchingfan Lv 1 1 pt. 7,337
  8. Avatar for dbuske 119. dbuske Lv 1 1 pt. 7,328
  9. Avatar for cenkonur 120. cenkonur Lv 1 1 pt. 7,189

Comments