Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for wozzarelli 121. wozzarelli Lv 1 1 pt. 6,941
  2. Avatar for prt19 122. prt19 Lv 1 1 pt. 6,805
  3. Avatar for Pawlak123701 123. Pawlak123701 Lv 1 1 pt. 6,476
  4. Avatar for altejoh 124. altejoh Lv 1 1 pt. 6,426
  5. Avatar for vizhu2018 125. vizhu2018 Lv 1 1 pt. 6,422
  6. Avatar for khendarg 126. khendarg Lv 1 1 pt. 6,287
  7. Avatar for Fowardint 127. Fowardint Lv 1 1 pt. 6,257
  8. Avatar for mitarcher 128. mitarcher Lv 1 1 pt. 6,256
  9. Avatar for FightingGold 129. FightingGold Lv 1 1 pt. 6,078
  10. Avatar for 01010011111 130. 01010011111 Lv 1 1 pt. 6,074

Comments