Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 20 pts. 9,681
  2. Avatar for phi16 42. phi16 Lv 1 19 pts. 9,678
  3. Avatar for Deleted player 43. Deleted player pts. 9,671
  4. Avatar for aznarog 44. aznarog Lv 1 18 pts. 9,656
  5. Avatar for alwen 45. alwen Lv 1 17 pts. 9,654
  6. Avatar for joremen 46. joremen Lv 1 16 pts. 9,640
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 15 pts. 9,627
  8. Avatar for johnmitch 48. johnmitch Lv 1 15 pts. 9,624
  9. Avatar for heather-1 49. heather-1 Lv 1 14 pts. 9,572
  10. Avatar for spvincent 50. spvincent Lv 1 13 pts. 9,569

Comments