Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for Deleted player 51. Deleted player 13 pts. 9,556
  2. Avatar for harvardman 52. harvardman Lv 1 12 pts. 9,537
  3. Avatar for jamiexq 53. jamiexq Lv 1 11 pts. 9,528
  4. Avatar for orily1337 54. orily1337 Lv 1 11 pts. 9,514
  5. Avatar for Cagdason 55. Cagdason Lv 1 10 pts. 9,508
  6. Avatar for tarimo 56. tarimo Lv 1 10 pts. 9,490
  7. Avatar for timroberts16 57. timroberts16 Lv 1 9 pts. 9,480
  8. Avatar for Crossed Sticks 58. Crossed Sticks Lv 1 9 pts. 9,437
  9. Avatar for benrh 59. benrh Lv 1 8 pts. 9,433
  10. Avatar for boondog 60. boondog Lv 1 8 pts. 9,403

Comments