Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups


  1. Avatar for Beta Folders 100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815

  1. Avatar for fpc 61. fpc Lv 1 7 pts. 9,389
  2. Avatar for Aminal88 62. Aminal88 Lv 1 7 pts. 9,339
  3. Avatar for Maerlyn138 63. Maerlyn138 Lv 1 7 pts. 9,331
  4. Avatar for Tehnologik1 64. Tehnologik1 Lv 1 6 pts. 9,330
  5. Avatar for jausmh 65. jausmh Lv 1 6 pts. 9,279
  6. Avatar for Altercomp 66. Altercomp Lv 1 6 pts. 9,278
  7. Avatar for Merf 67. Merf Lv 1 5 pts. 9,274
  8. Avatar for Bletchley Park 68. Bletchley Park Lv 1 5 pts. 9,250
  9. Avatar for DoctorSockrates 69. DoctorSockrates Lv 1 5 pts. 9,232
  10. Avatar for alcor29 70. alcor29 Lv 1 4 pts. 9,207

Comments