Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815
  1. Avatar for ehhan2018 131. ehhan2018 Lv 1 1 pt. 5,719
  2. Avatar for carsonfb 132. carsonfb Lv 1 1 pt. 5,238
  3. Avatar for larry25427 133. larry25427 Lv 1 1 pt. 5,182
  4. Avatar for leethobbit 134. leethobbit Lv 1 1 pt. 5,154
  5. Avatar for Dali En 135. Dali En Lv 1 1 pt. 5,102
  6. Avatar for Piup 136. Piup Lv 1 1 pt. 4,764
  7. Avatar for SiPot2018 137. SiPot2018 Lv 1 1 pt. 4,655
  8. Avatar for sboy171772 138. sboy171772 Lv 1 1 pt. 4,652
  9. Avatar for Alpha221 139. Alpha221 Lv 1 1 pt. 4,082
  10. Avatar for Hollinas 140. Hollinas Lv 1 1 pt. 0

Comments