Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,907
  2. Avatar for Deleted player 2. Deleted player pts. 10,903
  3. Avatar for smilingone 3. smilingone Lv 1 66 pts. 10,896
  4. Avatar for Deleted player 4. Deleted player 53 pts. 10,894
  5. Avatar for LociOiling 5. LociOiling Lv 1 42 pts. 10,893
  6. Avatar for lamoille 6. lamoille Lv 1 33 pts. 10,871
  7. Avatar for robgee 7. robgee Lv 1 26 pts. 10,861
  8. Avatar for alwen 8. alwen Lv 1 20 pts. 10,857
  9. Avatar for phi16 9. phi16 Lv 1 15 pts. 10,856
  10. Avatar for alcor29 10. alcor29 Lv 1 11 pts. 10,851

Comments