Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,907
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 10,896
  3. Avatar for Contenders 3. Contenders 61 pts. 10,858
  4. Avatar for Go Science 4. Go Science 47 pts. 10,796
  5. Avatar for HMT heritage 5. HMT heritage 35 pts. 10,795
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,779
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 10,749
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 10,725
  9. Avatar for Russian team 9. Russian team 10 pts. 10,719
  10. Avatar for Marvin's bunch 10. Marvin's bunch 7 pts. 10,634

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,906
  2. Avatar for Deleted player 2. Deleted player 97 pts. 10,890
  3. Avatar for tyler0911 3. tyler0911 Lv 1 94 pts. 10,872
  4. Avatar for crpainter 4. crpainter Lv 1 91 pts. 10,858
  5. Avatar for Aubade01 5. Aubade01 Lv 1 87 pts. 10,854
  6. Avatar for smilingone 6. smilingone Lv 1 84 pts. 10,840
  7. Avatar for georg137 7. georg137 Lv 1 81 pts. 10,830
  8. Avatar for robgee 8. robgee Lv 1 79 pts. 10,809
  9. Avatar for johnmitch 9. johnmitch Lv 1 76 pts. 10,804
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 73 pts. 10,796

Comments