Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,907
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 10,896
  3. Avatar for Contenders 3. Contenders 61 pts. 10,858
  4. Avatar for Go Science 4. Go Science 47 pts. 10,796
  5. Avatar for HMT heritage 5. HMT heritage 35 pts. 10,795
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,779
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 10,749
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 10,725
  9. Avatar for Russian team 9. Russian team 10 pts. 10,719
  10. Avatar for Marvin's bunch 10. Marvin's bunch 7 pts. 10,634
  1. Avatar for Hollinas 11. Hollinas Lv 1 8 pts. 10,781
  2. Avatar for actiasluna 12. actiasluna Lv 1 6 pts. 10,779
  3. Avatar for Skippysk8s 13. Skippysk8s Lv 1 4 pts. 10,764
  4. Avatar for silent gene 14. silent gene Lv 1 3 pts. 10,759
  5. Avatar for Sissue 15. Sissue Lv 1 2 pts. 10,759
  6. Avatar for ManVsYard 16. ManVsYard Lv 1 2 pts. 10,758
  7. Avatar for Maerlyn138 17. Maerlyn138 Lv 1 1 pt. 10,704
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 1 pt. 10,703
  9. Avatar for retiredmichael 19. retiredmichael Lv 1 1 pt. 10,657
  10. Avatar for jausmh 20. jausmh Lv 1 1 pt. 10,574

Comments