Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,907
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 10,896
  3. Avatar for Contenders 3. Contenders 61 pts. 10,858
  4. Avatar for Go Science 4. Go Science 47 pts. 10,796
  5. Avatar for HMT heritage 5. HMT heritage 35 pts. 10,795
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,779
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 10,749
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 10,725
  9. Avatar for Russian team 9. Russian team 10 pts. 10,719
  10. Avatar for Marvin's bunch 10. Marvin's bunch 7 pts. 10,634

  1. Avatar for reefyrob 21. reefyrob Lv 1 48 pts. 10,722
  2. Avatar for vakobo 22. vakobo Lv 1 46 pts. 10,719
  3. Avatar for nicobul 23. nicobul Lv 1 44 pts. 10,714
  4. Avatar for silent gene 24. silent gene Lv 1 43 pts. 10,713
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 41 pts. 10,701
  6. Avatar for Skippysk8s 26. Skippysk8s Lv 1 39 pts. 10,699
  7. Avatar for Deleted player 27. Deleted player pts. 10,687
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 36 pts. 10,687
  9. Avatar for Blipperman 29. Blipperman Lv 1 35 pts. 10,665
  10. Avatar for phi16 30. phi16 Lv 1 33 pts. 10,644

Comments