Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,907
  2. Avatar for Beta Folders 2. Beta Folders 79 pts. 10,896
  3. Avatar for Contenders 3. Contenders 61 pts. 10,858
  4. Avatar for Go Science 4. Go Science 47 pts. 10,796
  5. Avatar for HMT heritage 5. HMT heritage 35 pts. 10,795
  6. Avatar for Gargleblasters 6. Gargleblasters 26 pts. 10,779
  7. Avatar for Void Crushers 7. Void Crushers 19 pts. 10,749
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 10,725
  9. Avatar for Russian team 9. Russian team 10 pts. 10,719
  10. Avatar for Marvin's bunch 10. Marvin's bunch 7 pts. 10,634
  1. Avatar for NinjaGreg 41. NinjaGreg Lv 1 20 pts. 10,541
  2. Avatar for actiasluna 42. actiasluna Lv 1 19 pts. 10,527
  3. Avatar for YeshuaLives 43. YeshuaLives Lv 1 19 pts. 10,520
  4. Avatar for jermainiac 44. jermainiac Lv 1 18 pts. 10,484
  5. Avatar for Marvelz 45. Marvelz Lv 1 17 pts. 10,469
  6. Avatar for katling 46. katling Lv 1 16 pts. 10,468
  7. Avatar for MicElephant 47. MicElephant Lv 1 15 pts. 10,462
  8. Avatar for gdnskye 48. gdnskye Lv 1 15 pts. 10,461
  9. Avatar for tarimo 49. tarimo Lv 1 14 pts. 10,461
  10. Avatar for guineapig 50. guineapig Lv 1 13 pts. 10,458

Comments