Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups


  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,174
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,532
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,346
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,973
  5. Avatar for DW 2020 15. DW 2020 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,540
  7. Avatar for Deleted group 17. Deleted group pts. 5,503
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 0

  1. Avatar for Skippysk8s 11. Skippysk8s Lv 1 66 pts. 9,936
  2. Avatar for LociOiling 12. LociOiling Lv 1 63 pts. 9,932
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 60 pts. 9,894
  4. Avatar for Phyx 14. Phyx Lv 1 57 pts. 9,892
  5. Avatar for retiredmichael 15. retiredmichael Lv 1 55 pts. 9,887
  6. Avatar for nicobul 16. nicobul Lv 1 52 pts. 9,863
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 50 pts. 9,810
  8. Avatar for Marvelz 18. Marvelz Lv 1 48 pts. 9,806
  9. Avatar for reefyrob 19. reefyrob Lv 1 46 pts. 9,783
  10. Avatar for Blipperman 20. Blipperman Lv 1 43 pts. 9,773

Comments