Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,174
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,532
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,346
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,973
  5. Avatar for DW 2020 15. DW 2020 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,540
  7. Avatar for Deleted group 17. Deleted group pts. 5,503
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 0
  1. Avatar for vakobo 21. vakobo Lv 1 41 pts. 9,741
  2. Avatar for grogar7 22. grogar7 Lv 1 39 pts. 9,658
  3. Avatar for alcor29 23. alcor29 Lv 1 37 pts. 9,637
  4. Avatar for georg137 24. georg137 Lv 1 36 pts. 9,622
  5. Avatar for Deleted player 25. Deleted player pts. 9,597
  6. Avatar for silent gene 26. silent gene Lv 1 32 pts. 9,595
  7. Avatar for phi16 27. phi16 Lv 1 31 pts. 9,589
  8. Avatar for pvc78 28. pvc78 Lv 1 29 pts. 9,554
  9. Avatar for tarimo 29. tarimo Lv 1 28 pts. 9,550
  10. Avatar for jobo0502 30. jobo0502 Lv 1 26 pts. 9,537

Comments