Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,174
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,532
  3. Avatar for Hold My Beer 13. Hold My Beer 1 pt. 8,346
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,973
  5. Avatar for DW 2020 15. DW 2020 1 pt. 7,929
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 5,540
  7. Avatar for Deleted group 17. Deleted group pts. 5,503
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 0
  1. Avatar for spvincent 61. spvincent Lv 1 4 pts. 8,732
  2. Avatar for pfirth 62. pfirth Lv 1 4 pts. 8,676
  3. Avatar for cinnamonkitty 63. cinnamonkitty Lv 1 3 pts. 8,657
  4. Avatar for Hollinas 64. Hollinas Lv 1 3 pts. 8,626
  5. Avatar for MrZanav 65. MrZanav Lv 1 3 pts. 8,623
  6. Avatar for ManVsYard 66. ManVsYard Lv 1 3 pts. 8,590
  7. Avatar for navn 67. navn Lv 1 3 pts. 8,533
  8. Avatar for oureion 68. oureion Lv 1 2 pts. 8,532
  9. Avatar for Rastamasta 69. Rastamasta Lv 1 2 pts. 8,477
  10. Avatar for lconor 70. lconor Lv 1 2 pts. 8,470

Comments