Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386
  1. Avatar for silent gene 11. silent gene Lv 1 11 pts. 10,318
  2. Avatar for alcor29 12. alcor29 Lv 1 9 pts. 10,312
  3. Avatar for alwen 13. alwen Lv 1 7 pts. 10,294
  4. Avatar for Blipperman 14. Blipperman Lv 1 5 pts. 10,280
  5. Avatar for Maerlyn138 15. Maerlyn138 Lv 1 4 pts. 10,270
  6. Avatar for ManVsYard 16. ManVsYard Lv 1 3 pts. 10,268
  7. Avatar for Skippysk8s 17. Skippysk8s Lv 1 2 pts. 10,260
  8. Avatar for Phyx 18. Phyx Lv 1 1 pt. 10,252
  9. Avatar for timroberts16 19. timroberts16 Lv 1 1 pt. 10,114
  10. Avatar for LociOiling 20. LociOiling Lv 1 1 pt. 9,927

Comments