Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386
  1. Avatar for smilingone 21. smilingone Lv 1 1 pt. 9,926
  2. Avatar for Sissue 22. Sissue Lv 1 1 pt. 9,909
  3. Avatar for actiasluna 23. actiasluna Lv 1 1 pt. 9,905
  4. Avatar for reefyrob 24. reefyrob Lv 1 1 pt. 9,883
  5. Avatar for Deleted player 25. Deleted player pts. 9,799
  6. Avatar for retiredmichael 26. retiredmichael Lv 1 1 pt. 9,654
  7. Avatar for jausmh 27. jausmh Lv 1 1 pt. 9,491
  8. Avatar for orily1337 28. orily1337 Lv 1 1 pt. 9,308
  9. Avatar for dbuske 29. dbuske Lv 1 1 pt. 8,125

Comments