Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since about 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386

  1. Avatar for Hellcat6 101. Hellcat6 Lv 1 1 pt. 7,356
  2. Avatar for SapoPaleo 102. SapoPaleo Lv 1 1 pt. 7,185
  3. Avatar for frostschutz 103. frostschutz Lv 1 1 pt. 6,296
  4. Avatar for SiPot2018 104. SiPot2018 Lv 1 1 pt. 6,169
  5. Avatar for jdmclure 105. jdmclure Lv 1 1 pt. 6,158
  6. Avatar for 01010011111 106. 01010011111 Lv 1 1 pt. 5,954
  7. Avatar for doctaven 107. doctaven Lv 1 1 pt. 5,540
  8. Avatar for 4030_18_Abdelaziz 108. 4030_18_Abdelaziz Lv 1 1 pt. 5,503
  9. Avatar for Mao Mao 109. Mao Mao Lv 1 1 pt. 5,325
  10. Avatar for altejoh 110. altejoh Lv 1 1 pt. 5,093

Comments