Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386
  1. Avatar for momadoc 91. momadoc Lv 1 1 pt. 7,885
  2. Avatar for Philippe_C 92. Philippe_C Lv 1 1 pt. 7,880
  3. Avatar for ironchefnorse 93. ironchefnorse Lv 1 1 pt. 7,869
  4. Avatar for mitarcher 94. mitarcher Lv 1 1 pt. 7,795
  5. Avatar for ViJay7019 95. ViJay7019 Lv 1 1 pt. 7,775
  6. Avatar for congautruc 96. congautruc Lv 1 1 pt. 7,729
  7. Avatar for ehhan2018 97. ehhan2018 Lv 1 1 pt. 7,609
  8. Avatar for hajtogato 98. hajtogato Lv 1 1 pt. 7,561
  9. Avatar for ac281201 99. ac281201 Lv 1 1 pt. 7,547
  10. Avatar for xbp 100. xbp Lv 1 1 pt. 7,467

Comments