Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386
  1. Avatar for Cagdason 41. Cagdason Lv 1 14 pts. 9,174
  2. Avatar for YeshuaLives 42. YeshuaLives Lv 1 13 pts. 9,152
  3. Avatar for TastyMunchies 43. TastyMunchies Lv 1 13 pts. 9,122
  4. Avatar for smilingone 44. smilingone Lv 1 12 pts. 9,115
  5. Avatar for WBarme1234 45. WBarme1234 Lv 1 11 pts. 9,092
  6. Avatar for guineapig 46. guineapig Lv 1 11 pts. 9,074
  7. Avatar for crpainter 47. crpainter Lv 1 10 pts. 9,036
  8. Avatar for Mike Cassidy 48. Mike Cassidy Lv 1 9 pts. 9,029
  9. Avatar for benrh 49. benrh Lv 1 9 pts. 9,029
  10. Avatar for Deleted player 50. Deleted player pts. 9,016

Comments