Placeholder image of a protein
Icon representing a puzzle

1649: Unsolved De-novo Freestyle 149

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEVLYLKDADVEQVVRYIRQKNAEVLVVVVNFDEEQIRIIVRVVIQIVQAEVVIVVINMEEEQVKKVVNQVNVKVVVVIK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,434
  2. Avatar for Go Science 2. Go Science 74 pts. 10,322
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,280
  4. Avatar for Void Crushers 4. Void Crushers 38 pts. 10,222
  5. Avatar for Beta Folders 5. Beta Folders 27 pts. 9,932
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,894
  7. Avatar for Russian team 7. Russian team 12 pts. 9,741
  8. Avatar for Contenders 8. Contenders 8 pts. 9,622
  9. Avatar for Marvin's bunch 9. Marvin's bunch 5 pts. 9,491
  10. Avatar for HMT heritage 10. HMT heritage 3 pts. 9,386
  1. Avatar for heather-1 51. heather-1 Lv 1 8 pts. 8,999
  2. Avatar for jausmh 52. jausmh Lv 1 7 pts. 8,984
  3. Avatar for Vincera 53. Vincera Lv 1 7 pts. 8,906
  4. Avatar for harvardman 54. harvardman Lv 1 6 pts. 8,862
  5. Avatar for Sissue 55. Sissue Lv 1 6 pts. 8,811
  6. Avatar for poiuytrewq987 56. poiuytrewq987 Lv 1 5 pts. 8,798
  7. Avatar for johnmitch 57. johnmitch Lv 1 5 pts. 8,795
  8. Avatar for stomjoh 58. stomjoh Lv 1 5 pts. 8,740
  9. Avatar for Arne Heessels 59. Arne Heessels Lv 1 4 pts. 8,739
  10. Avatar for katling 60. katling Lv 1 4 pts. 8,733

Comments