Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,133
  2. Avatar for smilingone 2. smilingone Lv 1 84 pts. 11,127
  3. Avatar for ManVsYard 3. ManVsYard Lv 1 70 pts. 11,051
  4. Avatar for Skippysk8s 4. Skippysk8s Lv 1 57 pts. 11,050
  5. Avatar for tomespen 5. tomespen Lv 1 47 pts. 11,049
  6. Avatar for Deleted player 6. Deleted player pts. 11,049
  7. Avatar for Sissue 7. Sissue Lv 1 30 pts. 11,048
  8. Avatar for retiredmichael 8. retiredmichael Lv 1 24 pts. 11,044
  9. Avatar for reefyrob 9. reefyrob Lv 1 19 pts. 11,024
  10. Avatar for Norrjane 10. Norrjane Lv 1 15 pts. 11,017

Comments