Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Beta Folders 100 pts. 11,133
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 11,061
  3. Avatar for Go Science 3. Go Science 56 pts. 11,020
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 11,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 10,986
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 10,917
  7. Avatar for Hold My Beer 7. Hold My Beer 14 pts. 10,909
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,877
  9. Avatar for Russian team 9. Russian team 6 pts. 10,864
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,858

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 11,071
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 11,070
  3. Avatar for actiasluna 3. actiasluna Lv 1 94 pts. 11,061
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 90 pts. 11,020
  5. Avatar for grogar7 5. grogar7 Lv 1 87 pts. 10,992
  6. Avatar for phi16 6. phi16 Lv 1 84 pts. 10,985
  7. Avatar for Aubade01 7. Aubade01 Lv 1 81 pts. 10,982
  8. Avatar for MicElephant 8. MicElephant Lv 1 78 pts. 10,980
  9. Avatar for jobo0502 9. jobo0502 Lv 1 75 pts. 10,972
  10. Avatar for tyler0911 10. tyler0911 Lv 1 72 pts. 10,968

Comments