Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 11,071
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 11,070
  3. Avatar for actiasluna 3. actiasluna Lv 1 94 pts. 11,061
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 90 pts. 11,020
  5. Avatar for grogar7 5. grogar7 Lv 1 87 pts. 10,992
  6. Avatar for phi16 6. phi16 Lv 1 84 pts. 10,985
  7. Avatar for Aubade01 7. Aubade01 Lv 1 81 pts. 10,982
  8. Avatar for MicElephant 8. MicElephant Lv 1 78 pts. 10,980
  9. Avatar for jobo0502 9. jobo0502 Lv 1 75 pts. 10,972
  10. Avatar for tyler0911 10. tyler0911 Lv 1 72 pts. 10,968

Comments