Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,373
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208
  1. Avatar for Qaz_Luknas 91. Qaz_Luknas Lv 1 1 pt. 9,981
  2. Avatar for Lyshi2018 92. Lyshi2018 Lv 1 1 pt. 9,979
  3. Avatar for oureion 93. oureion Lv 1 1 pt. 9,957
  4. Avatar for jebbiek 94. jebbiek Lv 1 1 pt. 9,956
  5. Avatar for Threeoak 95. Threeoak Lv 1 1 pt. 9,947
  6. Avatar for PlagueRat 96. PlagueRat Lv 1 1 pt. 9,940
  7. Avatar for lconor 97. lconor Lv 1 1 pt. 9,935
  8. Avatar for alwan2018 98. alwan2018 Lv 1 1 pt. 9,874
  9. Avatar for ManVsYard 99. ManVsYard Lv 1 1 pt. 9,827
  10. Avatar for RyeSnake 100. RyeSnake Lv 1 1 pt. 9,799

Comments