Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208

  1. Avatar for jdmclure 111. jdmclure Lv 1 1 pt. 9,590
  2. Avatar for Swiper 112. Swiper Lv 1 1 pt. 9,587
  3. Avatar for hajtogato 113. hajtogato Lv 1 1 pt. 9,572
  4. Avatar for ehhan2018 114. ehhan2018 Lv 1 1 pt. 9,535
  5. Avatar for felixxy 115. felixxy Lv 1 1 pt. 9,508
  6. Avatar for lange 116. lange Lv 1 1 pt. 9,495
  7. Avatar for lamoille 117. lamoille Lv 1 1 pt. 9,448
  8. Avatar for MsHsi 119. MsHsi Lv 1 1 pt. 9,441
  9. Avatar for aspadistra 120. aspadistra Lv 1 1 pt. 9,440

Comments