Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,373
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208
  1. Avatar for dbuske 131. dbuske Lv 1 1 pt. 9,154
  2. Avatar for Knoblerine 132. Knoblerine Lv 1 1 pt. 9,150
  3. Avatar for Crossed Sticks 133. Crossed Sticks Lv 1 1 pt. 9,117
  4. Avatar for rmoretti 134. rmoretti Lv 1 1 pt. 8,565
  5. Avatar for Wondry 135. Wondry Lv 1 1 pt. 8,565
  6. Avatar for 01010011111 136. 01010011111 Lv 1 1 pt. 8,079
  7. Avatar for JaesangHan 137. JaesangHan Lv 1 1 pt. 7,545
  8. Avatar for content 138. content Lv 1 1 pt. 5,843
  9. Avatar for joaniegirl 139. joaniegirl Lv 1 1 pt. 5,843
  10. Avatar for uihcv 140. uihcv Lv 1 1 pt. 5,843

Comments