Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,373
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208
  1. Avatar for Galaxie 11. Galaxie Lv 1 70 pts. 10,965
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 67 pts. 10,961
  3. Avatar for robgee 13. robgee Lv 1 65 pts. 10,957
  4. Avatar for silent gene 14. silent gene Lv 1 62 pts. 10,942
  5. Avatar for Deleted player 15. Deleted player pts. 10,925
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 57 pts. 10,917
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 55 pts. 10,911
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 53 pts. 10,909
  9. Avatar for TastyMunchies 19. TastyMunchies Lv 1 51 pts. 10,901
  10. Avatar for fpc 20. fpc Lv 1 49 pts. 10,894

Comments