Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,373
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208
  1. Avatar for O Seki To 21. O Seki To Lv 1 47 pts. 10,877
  2. Avatar for Skippysk8s 22. Skippysk8s Lv 1 45 pts. 10,868
  3. Avatar for Deleted player 23. Deleted player pts. 10,866
  4. Avatar for vakobo 24. vakobo Lv 1 42 pts. 10,864
  5. Avatar for jausmh 25. jausmh Lv 1 40 pts. 10,858
  6. Avatar for joremen 26. joremen Lv 1 38 pts. 10,848
  7. Avatar for timroberts16 27. timroberts16 Lv 1 37 pts. 10,829
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 35 pts. 10,822
  9. Avatar for YeshuaLives 29. YeshuaLives Lv 1 34 pts. 10,818
  10. Avatar for nicobul 30. nicobul Lv 1 32 pts. 10,817

Comments