Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,373
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208
  1. Avatar for frood66 41. frood66 Lv 1 19 pts. 10,713
  2. Avatar for diamonddays 42. diamonddays Lv 1 18 pts. 10,712
  3. Avatar for Phyx 43. Phyx Lv 1 18 pts. 10,712
  4. Avatar for Alistair69 44. Alistair69 Lv 1 17 pts. 10,692
  5. Avatar for aznarog 45. aznarog Lv 1 16 pts. 10,688
  6. Avatar for reefyrob 46. reefyrob Lv 1 15 pts. 10,664
  7. Avatar for guineapig 47. guineapig Lv 1 14 pts. 10,659
  8. Avatar for NinjaGreg 48. NinjaGreg Lv 1 14 pts. 10,656
  9. Avatar for DoctorSockrates 49. DoctorSockrates Lv 1 13 pts. 10,652
  10. Avatar for Blipperman 50. Blipperman Lv 1 12 pts. 10,639

Comments