Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,373
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208
  1. Avatar for Museka 51. Museka Lv 1 12 pts. 10,611
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 11 pts. 10,608
  3. Avatar for jamiexq 53. jamiexq Lv 1 11 pts. 10,587
  4. Avatar for heather-1 54. heather-1 Lv 1 10 pts. 10,564
  5. Avatar for zgf2022 55. zgf2022 Lv 1 9 pts. 10,544
  6. Avatar for carsonfb 56. carsonfb Lv 1 9 pts. 10,541
  7. Avatar for Anfinsen_slept_here 57. Anfinsen_slept_here Lv 1 8 pts. 10,527
  8. Avatar for jermainiac 58. jermainiac Lv 1 8 pts. 10,526
  9. Avatar for toshiue 59. toshiue Lv 1 8 pts. 10,516
  10. Avatar for rezaefar 60. rezaefar Lv 1 7 pts. 10,479

Comments