Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Contenders 11. Contenders 2 pts. 10,797
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,420
  3. Avatar for GENE 433 13. GENE 433 1 pt. 10,032
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,979
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,957
  6. Avatar for freefolder 16. freefolder 1 pt. 9,754
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 9,440
  8. Avatar for Team Schleswig-Holstein 18. Team Schleswig-Holstein 1 pt. 9,373
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,208
  1. Avatar for tarimo 61. tarimo Lv 1 7 pts. 10,474
  2. Avatar for Flagg65a 62. Flagg65a Lv 1 6 pts. 10,471
  3. Avatar for DodoBird 63. DodoBird Lv 1 6 pts. 10,442
  4. Avatar for Aminal88 64. Aminal88 Lv 1 6 pts. 10,438
  5. Avatar for pvc78 65. pvc78 Lv 1 5 pts. 10,425
  6. Avatar for JasperD 66. JasperD Lv 1 5 pts. 10,420
  7. Avatar for WBarme1234 67. WBarme1234 Lv 1 5 pts. 10,414
  8. Avatar for Maerlyn138 68. Maerlyn138 Lv 1 4 pts. 10,405
  9. Avatar for altejoh 69. altejoh Lv 1 4 pts. 10,393
  10. Avatar for Sissue 70. Sissue Lv 1 4 pts. 10,390

Comments