Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,133
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 11,061
  3. Avatar for Go Science 3. Go Science 56 pts. 11,020
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 11,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 10,986
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 10,917
  7. Avatar for Hold My Beer 7. Hold My Beer 14 pts. 10,909
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,877
  9. Avatar for Russian team 9. Russian team 6 pts. 10,864
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,858
  1. Avatar for Deleted player 21. Deleted player pts. 10,940
  2. Avatar for alcor29 22. alcor29 Lv 1 1 pt. 10,936
  3. Avatar for alwen 23. alwen Lv 1 1 pt. 10,934
  4. Avatar for jermainiac 24. jermainiac Lv 1 1 pt. 10,924
  5. Avatar for Maerlyn138 25. Maerlyn138 Lv 1 1 pt. 10,834
  6. Avatar for Alistair69 26. Alistair69 Lv 1 1 pt. 10,709
  7. Avatar for content 27. content Lv 1 1 pt. 10,505
  8. Avatar for jamiexq 28. jamiexq Lv 1 1 pt. 10,050
  9. Avatar for dbuske 29. dbuske Lv 1 1 pt. 10,002

Comments