Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Beta Folders 100 pts. 11,133
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 11,061
  3. Avatar for Go Science 3. Go Science 56 pts. 11,020
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 11,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 10,986
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 10,917
  7. Avatar for Hold My Beer 7. Hold My Beer 14 pts. 10,909
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,877
  9. Avatar for Russian team 9. Russian team 6 pts. 10,864
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,858

  1. Avatar for stomjoh 71. stomjoh Lv 1 4 pts. 10,354
  2. Avatar for alwen 72. alwen Lv 1 4 pts. 10,351
  3. Avatar for harvardman 73. harvardman Lv 1 3 pts. 10,289
  4. Avatar for alcor29 74. alcor29 Lv 1 3 pts. 10,288
  5. Avatar for Glen B 75. Glen B Lv 1 3 pts. 10,274
  6. Avatar for abiogenesis 76. abiogenesis Lv 1 3 pts. 10,263
  7. Avatar for cbwest 77. cbwest Lv 1 3 pts. 10,223
  8. Avatar for ironchefnorse 78. ironchefnorse Lv 1 2 pts. 10,195
  9. Avatar for Hiro Protagonist 79. Hiro Protagonist Lv 1 2 pts. 10,191
  10. Avatar for benrh 80. benrh Lv 1 2 pts. 10,179

Comments