Placeholder image of a protein
Icon representing a puzzle

1654: Revisiting Puzzle 115: Exocyst

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,133
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 11,061
  3. Avatar for Go Science 3. Go Science 56 pts. 11,020
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 11,014
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 29 pts. 10,986
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 10,917
  7. Avatar for Hold My Beer 7. Hold My Beer 14 pts. 10,909
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,877
  9. Avatar for Russian team 9. Russian team 6 pts. 10,864
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,858
  1. Avatar for Norrjane 31. Norrjane Lv 1 31 pts. 10,801
  2. Avatar for manu8170 32. manu8170 Lv 1 29 pts. 10,798
  3. Avatar for Bletchley Park 33. Bletchley Park Lv 1 28 pts. 10,797
  4. Avatar for crpainter 34. crpainter Lv 1 27 pts. 10,794
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 26 pts. 10,783
  6. Avatar for johnmitch 36. johnmitch Lv 1 25 pts. 10,761
  7. Avatar for Vinara 37. Vinara Lv 1 23 pts. 10,730
  8. Avatar for Marvelz 38. Marvelz Lv 1 22 pts. 10,723
  9. Avatar for Merf 39. Merf Lv 1 21 pts. 10,722
  10. Avatar for georg137 40. georg137 Lv 1 20 pts. 10,714

Comments