Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 3 pts. 9,635
  2. Avatar for GENE 433 12. GENE 433 2 pts. 9,559
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,504
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,353
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 9,313
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,306
  7. Avatar for freefolder 17. freefolder 1 pt. 9,277
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 8,943
  9. Avatar for Italiani Al Lavoro 19. Italiani Al Lavoro 1 pt. 8,938
  10. Avatar for SHELL 20. SHELL 1 pt. 8,464
  1. Avatar for timroberts16 41. timroberts16 Lv 1 22 pts. 9,674
  2. Avatar for Norrjane 42. Norrjane Lv 1 21 pts. 9,670
  3. Avatar for christioanchauvin 43. christioanchauvin Lv 1 20 pts. 9,669
  4. Avatar for guineapig 44. guineapig Lv 1 19 pts. 9,666
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 19 pts. 9,659
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 18 pts. 9,658
  7. Avatar for hansvandenhof 47. hansvandenhof Lv 1 17 pts. 9,657
  8. Avatar for bertro 48. bertro Lv 1 16 pts. 9,655
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 15 pts. 9,650
  10. Avatar for Blipperman 50. Blipperman Lv 1 15 pts. 9,649

Comments