Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,768
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,765
  3. Avatar for HMT heritage 3. HMT heritage 58 pts. 9,756
  4. Avatar for Contenders 4. Contenders 43 pts. 9,751
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,746
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,746
  7. Avatar for Go Science 7. Go Science 15 pts. 9,741
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 9,738
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 9,717
  10. Avatar for Russian team 10. Russian team 5 pts. 9,709
  1. Avatar for timroberts16 41. timroberts16 Lv 1 22 pts. 9,674
  2. Avatar for Norrjane 42. Norrjane Lv 1 21 pts. 9,670
  3. Avatar for christioanchauvin 43. christioanchauvin Lv 1 20 pts. 9,669
  4. Avatar for guineapig 44. guineapig Lv 1 19 pts. 9,666
  5. Avatar for YeshuaLives 45. YeshuaLives Lv 1 19 pts. 9,659
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 18 pts. 9,658
  7. Avatar for hansvandenhof 47. hansvandenhof Lv 1 17 pts. 9,657
  8. Avatar for bertro 48. bertro Lv 1 16 pts. 9,655
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 15 pts. 9,650
  10. Avatar for Blipperman 50. Blipperman Lv 1 15 pts. 9,649

Comments