Placeholder image of a protein
Icon representing a puzzle

1656: Revisiting Puzzle 117: Transport Mutant

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 01, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,768
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 9,765
  3. Avatar for HMT heritage 3. HMT heritage 58 pts. 9,756
  4. Avatar for Contenders 4. Contenders 43 pts. 9,751
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 9,746
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 9,746
  7. Avatar for Go Science 7. Go Science 15 pts. 9,741
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 9,738
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 9,717
  10. Avatar for Russian team 10. Russian team 5 pts. 9,709
  1. Avatar for ralan-nsk 111. ralan-nsk Lv 1 1 pt. 9,209
  2. Avatar for Threeoak 112. Threeoak Lv 1 1 pt. 9,206
  3. Avatar for gdnskye 113. gdnskye Lv 1 1 pt. 9,193
  4. Avatar for Ref_Jo 114. Ref_Jo Lv 1 1 pt. 9,178
  5. Avatar for abiogenesis 115. abiogenesis Lv 1 1 pt. 9,175
  6. Avatar for PlagueRat 116. PlagueRat Lv 1 1 pt. 9,164
  7. Avatar for Knoblerine 117. Knoblerine Lv 1 1 pt. 9,139
  8. Avatar for 181818 118. 181818 Lv 1 1 pt. 9,124
  9. Avatar for SiPot2018 119. SiPot2018 Lv 1 1 pt. 9,121
  10. Avatar for Philippe_C 120. Philippe_C Lv 1 1 pt. 9,099

Comments